PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_55877.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 104aa    MW: 12432.5 Da    PI: 9.9865
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_55877.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM129.62.3e-4011044109
                      NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                              GfrFhPtdeel+v+yL++kve+k+++l e ik++diyk++PwdLp+  + + kewyfF+ r +ky+++ r+nr+t+sg+Wkatg d
  Rsa1.0_55877.1_g00001.1   1 GFRFHPTDEELLVYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVGAKEWYFFCMRGRKYKNSVRPNRVTDSGFWKATGID 85 
                              9**************************.99***************77777999********************************* PP

                      NAM  90 kevlskkgelvglkktLvfy 109
                              k+v+s +   vglkk+Lv+y
  Rsa1.0_55877.1_g00001.1  86 KPVYS-NLDCVGLKKSLVYY 104
                              *****.9999*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF023656.8E-191104IPR003441NAC domain
PROSITE profilePS5100540.5361104IPR003441NAC domain
SuperFamilySSF1019416.15E-411104IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
GFRFHPTDEE LLVYYLRRKV ENKPIKLELI KQIDIYKFDP WDLPRVSSVG AKEWYFFCMR  60
GRKYKNSVRP NRVTDSGFWK ATGIDKPVYS NLDCVGLKKS LVYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-38110418121Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756691e-110KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142151.12e-68PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK552e-68NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A078HWF72e-69A0A078HWF7_BRANA; BnaC03g23960D protein
TrEMBLA0A0D3B6F41e-69A0A0D3B6F4_BRAOL; Uncharacterized protein
STRINGBra037743.1-P7e-68(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-69NAC domain containing protein 42